General Information

  • ID:  hor004768
  • Uniprot ID:  E7AIL2
  • Protein name:  Arg0, Trp5, Leu8-bradykinin
  • Gene name:  kininogen-1
  • Organism:  Pelophylax lessonae (Pool frog) (Rana lessonae)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pelophylax (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RRPPGWSPLR
  • Length:  10
  • Propeptide:  MFTMKKSLLLFFFLGIVSLSLCKEERDADEEENEETGGEVKVEEVKRQKTYNRRPPGWSPLRIAPTNV
  • Signal peptide:  MFTMKKSLLLFFFLGIVSLSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be an antagonist of bradykinin-induced relaxation of rat arterial smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E7AIL2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004768_AF2.pdbhor004768_ESM.pdb

Physical Information

Mass: 138212 Formula: C55H88N20O12
Absent amino acids: ACDEFHIKMNQTVY Common amino acids: PR
pI: 12.8 Basic residues: 3
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -166 Boman Index: -3997
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 39
Instability Index: 18034 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  20923691
  • Title:  A Fish Bradykinin (Arg0, Trp5, Leu8-bradykinin) From the Defensive Skin Secretion of the European Edible Frog, Pelophylax Kl. Esculentus: Structural Characterization; Molecular Cloning of Skin Kininogen cDNA and Pharmacological Effects on Mammalian Smooth Muscle